GenomeNet

>lhu:105670420 K12567 titin [EC:2.7.11.1] | (RefSeq) uncharacterized protein LOC105670420 (A)
MGNASTKDYSKSISVGTSSRKAHWDYPGLPAPPGKPILISGTNEAQPDIVAIRWDRSPSN
GGSAIVGYLVEHRRLGSSHWVRSASGLCAFPELTLSGLEPGWRYQFRVRAQNAVGLSRPS
EVSEPLTVTLQKAVAACAPNFDLELKDTITLENEQAEFVVQFSGTPLPKISWFKDGFEIF
SSRRTRIITDNGKSVLLIHQTALNDEGEIKCTATNRAGHIATRAKLILEASPRIRLPRQY
EDGLLFEQDETIRLKVSLAGRPSPVVTWYHDGELISKDERHVFEVMDGESILKIPDAKRK
DRGEYTVKATNKLGEDAASFLVTVTDRPAAPGKVTVAMSLGKSVTLSWKEPEDDGGCKIG
TYIIEYYRIGWEVWLKATTSRCTTATLTELIEGSEYKFRVKAENPYGVSDPSEESDVIFI
PGPKRRVAAPLSEKSQSHREISRSRGEKREVSIATQRTRSLTREEARTRNDEDDNRFVYE
ERSASTQRLATAMLDRPSRADSRVTFAPDTLEKEEPPVPPVRSREHASAKQEVSYGNHTD
RSNITADARNKQDVVRRERTMSPKPAIITISSPVEEDPRLHSLAMSRERRSLSPLSMPII
QEQREENRITASRDLVPSSNSILKRQTAVVNELMVSPPSSPQGMLREDDENALHGSSEFM
LVLYPEDEIQEKDAIDAANGAETRIKRSTNNRPDIIELTEDEDDLIPPPISLSLPELFSV
QHQVVEVMRHAVSSTELLHERAMERFYRAVAAEEAVENTKQKTQLERLTGELAQSDAESV
QRSSSLRRRLSNSSVATQNLVASWQIKKTRRRLSEGQTDATEKTMKLLSPLLPDVEARSD
PNLPLETTMVDPWRKDAKNESVKRLRRWHEANVTLLEEELMETNNEEEEIVFSILNKTEF
QQPIQATTREAEMEEDYSIEISEESSEEISSADSEDLKLLKSRILARQIMDEEDTYHPRG
RSVPHVEPEFPHISPDRVPSLEILPPPPVRAVTPVSPNNVMPKSILKKPKEETSQDNFAK
LIPPEKPIRKILSQPYETEDAEETSIDIGEKISDLANMSETLKTPAMSESDTNSILSAAE
AAKSRRMQSKLRSMTPEEEAAESEARMAVVNQYTEIVREYSSHSRHNSAPSSRRSSISED
QDQKHRVQEKLVPKLINKQEHDEASQLKIKNKDKTDKQKKNNQAPASKREGVNSRGTTPA
KDTMIAKEKRGSRPSSRDQSPATRKKERTGGASSRSSSKTRNRTPSQERSNRPLAKNDTG
EQDSRRSKVPSRPSSRSRSNSRERFGATSVESKVEKLQKALESNKYRATRKDSEVAKENA
EKGSPDRVDGNQLALEAKQTVRSTVSYVTDLTLLMAAMYVYFFKRETLAVPFIVLLLYRR
IQEEIRGWMPRRWWRSTKKR

BLAST