GenomeNet

>lpa:lpa_01518 no KO assigned | (GenBank) hypothetical protein (A)
MSQPSSRHLSHDFPAWKGLSLRELFWIVITTTPVTTLLFILLGTMAGYPLAAGCIGFVIG
FIFSITVWPKGVARIKAGKPYGYVMKKTIQWMVRLRLKHSPWIHYQGQWQKNKSVGEPHV

BLAST