GenomeNet

>lpk:LACPI_0824 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) pdhC; Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex PdhC (A)
MTEIFKMPDVGEGMAEGEIASWLVKVGDAIKEDDPIAEIQNDKLLQEILSPYTGVVTKLY
VEAGTVVEVGAPLVEFDGDGSGASEAAPVAPEAAVPTAAPTPVAAEAAPTAPASGKVGAP
VIGGQVRAMPSVRRLARQNGIDLTTVPANGRHGNITLEDVRNVLSGATVAPEAPVSAEVS
ETPEAVATPAAAPKAVVSEKAGRVPMTPIRKAIAKNMTSQKQNVPHVTLFEQVEVSKLMA
HRAAFKDIALKQDVKLTYMAYVAKALAAMAKHFPDLNAHVDMAKTEIVYPEGIHIGIAVD
TPNGLFVPVVKNADQKSILAIAKEIAELAERARDGKLTPDVASGSTITISNIGSARGNWF
TPVINVNEAAILGLGTIAKEPIVNEEGEIVVGNMMKLSLSFDHRLVDGMLAQSAINDLKK
MLNDPAYMLMEV

BLAST