GenomeNet

>lpp:lpp1071 no KO assigned | (GenBank) hypothetical protein (A)
MLKLSTLAMGLVLGQQAIAGLYIPGIATSPMQQADNALAKAGLTEFLDEVIEEKDFQLND
AQKQEAKVWGLNEKEEKRYLQLMQSRSGVYYKNLRMTPIDILGLNARDDVEREHFASLAA
RQEAQKVAQNIAWNNAFYKAYNELFKDVPVVGDFDPSPYSPYAHQPIQLKAGETLYLFIR
PDDAVTTIVLQLIDAINRTPNTKLNLLFLDMDNNTIQLWANRHQIPIQLVTSQQITLTPG
NQQFEGLTLAKKQTPLLLIANGKTSQVVDLGRF

BLAST