GenomeNet

>lrm:LRC_17150 K03367 D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13] | (GenBank) D-alanine--poly(phosphoribitol) ligase subunit 1 (A)
MENIISRIDRIATENPDRIAYDYLGRTNTYGELKEKSDALAAYLKASNLPEKAPLIVFGG
QDFQMIATFLGIVKSGRAYIPVDVHSSEDRVKVIEEIAKPAACIALSELPETGREVPVIS
RERLDEIMAEEGKSVSEEDYVKGDDDFYVIFTSGTTGKPKGVRIAHDDLASFVDWMDRDF
GLEKEQTALSQAPYSFDLSVMDLYPTLTNGGKLEVLPKETTDNFKQLFSRLPEMKVNTWV
STPSFADICLLSKEFDEKHLPDLKRFMFCGEELTHQTAQRLRERFPNAQVFNTYGPTEAT
VAVTQTEITDEVLENYQRLPIGVCKEDAKIILLDENGNEAEAGKAGEITIVGAGVSKGYL
NNPEKTNQAFFEYEGKRAYRTGDLGRFDSNGQLMYMGRLDFQVKLHGYRIELEDVDQCLS
HVSLVERAATVPRYDGNHKVSQLIAYVVLKNAEFENEFKMTQAIKEELKETMMPYMMPQR
FVYVETLPLTQNGKVDRKSLIKEVNR

BLAST