GenomeNet

>mai:MICA_493 K16011 mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8] | (GenBank) nucleotidyl transferase family protein (A)
MLHNIIPVILCGGVGRRLWPLSTPRRPKPFLRDMSGQSLLQQTMDRARGMKPPVIVCNKI
HADLVRRDIGTTSSALLLEPCGRNTAPAMVAAAHYIQREFGSDAVMLIMPSDHFMADPAA
VGRAALTLWPYLDHDIVGVFGVRPTRAETGYGYIQVDVGAHARPGSHAVRSFVEKPDREL
AQTYLDQGCWWWNSGLFLARAKTLLDHAQTHASAAYVATGRAVENGVWDQQALHLSSDFA
DAPAVSFDKAVMERIGGVRVAALETVWSDLGTWSALAKNMCANLFSTG

BLAST