GenomeNet

>malb:109971588 K03283 heat shock 70kDa protein 1/2/6/8 | (RefSeq) heat shock 70 kDa protein-like (A)
MSSAKGISIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPTNTVFDAKRLIGRKFSDPVVQADMKLWPFKVINDNGKPKVQVEYKGEIKAFYPEE
ISSMVLVKMKEVAEAYLGQKLSNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTA
AAIAYGLDKGKRGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMV
KHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSIT
RARFEELNSELFRGTLEPVEKALQDAKLDKSKIHEIVLVGGSTRIPKIQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAILMGDTSKNVQDLLLLDVAPLSLGIETAGGVMTPLIKRNT
TIPTKQTQIFSTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQVEVTF
DIDANGILNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKSEDDLQREKIAA
KNSLESYAYHMKSSVEDETMKGKISEEDKKTVIDKCNQTISWLESNQLAETDEYEHQQKE
LESVCKPIITKLYQGAAAGGCDSQAKGSSQGPTIEEVD

BLAST