GenomeNet

>mbah:HYN46_02915 K00681 gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13] | (GenBank) gamma-glutamyltransferase family protein (A)
MVTSPHTLASAAGLEVLKAGGNAIEAAIAVATALSVTYPHFNGLGGDAFWVISDQSGAVQ
TISGIGQAAVQLPDFSGAIPQRGARSALTTAAAVDSWDQAYQISKTQWRGQQSWPSLFNR
AIEYASVGFPVTESQHFWQRLRGNVLRDLSGFSETFAPGGGLLSIGEHFAQPQLARSLEC
IAQYGAREFYEGDLAADIASGLEQAGSPIRLADLVHTHARVESPLRVAYRDGELVSLRPP
TQGVTTLQIMGILDRFDMSTIAEGSADYYHLLVEAVKCAFRDRDRLVCDPDYKSVPIDHM
LSSAVLDAHAQSIHLQHARAWPEVFKHGDTAFIGVCDQEGRCVSLLQTIYFDWGSGIVAG
DTGILWHNRGASFSTDPLHHNALQSGKRPFHTLNPGMYLKEGRPHLLFGTQGADGQPQTL
AAILTRLIDYQMDPYTALARPRFLLGKTFSDTRDALKLEEDAGRSVFAELTARGHEVSAI
PAQSQLAGHPGVIRIDADHTLTGAHDPRSNGLAIGL

BLAST