GenomeNet

>mcal:110305582 K02890 large subunit ribosomal protein L22 | (RefSeq) Mrpl22; 39S ribosomal protein L22, mitochondrial (A)
MAAALLRELGALRLPNLRIWATQTLRVLPPSCIHTSASLDISRKWEKKNKIVYPPQLPGE
PRRPAEIYHCRRQIKYSKDKMWYLAKMIRGMSIDQALAQLEFNDKKGAQIIKEVLLEAQD
MAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPP
EVPKTAVDHAKDYIQQLRSRTIIHTL

BLAST