GenomeNet

>mema:MMAB1_2622 K00528 ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1] | (GenBank) Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog (fragment) (A)
MKRLYKVELATKLADRVYEYWIHAPQVAHHARAGQFLILRLHETGERIPLTISAVRGDAV
RVIFMAVGKTTQELATLRAGDSIKDVAGPLGKPSEIGKYGTCCVIGGGVGIASTPLIAKE
LKEAGNHVIGIIGARSADLLILEDEMRAICDELYITTDDGSKGVHGFASDVLKGLLNERT
INRVWIIGPAIMMKVTSGVTVPYGVKTYVSSIRLWSTGPGCADPAG

BLAST