GenomeNet

>miu:ABE85_20130 K01008 selenide, water dikinase [EC:2.7.9.3] | (GenBank) segregation protein A (A)
MTPHDASPAPVSEPRLTSLSHGGGCGCKIAPGVLSEILKSTNALPVPKELLVGIETSDDA
AVYRLNDEQALVATTDFFMPIVDDPHDFGRIAATNAISDVYAMGGRPIMALALVGMPIAV
LSAATIGRILEGGASVCRQAGIPIAGGHTIDSVEPIYGLVALGLVHPSRVKRNADAKVGD
VLVLGKALGVGVMSAALKKGRLDDASYQRMLETTTLLNTPGPELAALDGVHALTDVTGFG
LAGHALEIARGSRCGIELDWAAVPLLEGVRSLAADGLITGASGRNWSAYGTEIALSASLP
TETQALLSDPQTSGGLLVSCTPAAVGHVLDVFARHGFGAASVIGRLVASDDGARLKVS

BLAST