GenomeNet

>mkc:kam1_1616 K06195 ApaG protein | (GenBank) uncharacterized protein (A)
MEEFLKVNEIKVIIEHLEYERSKSHSSNYLYVCFYYISILNFSPKTVLLKGRKWIVTNDL
GEKTVIEGMGIVGTYPRLKMGEKFRYSSHHFYSRPSVVEGSYFGIDSEGSLIVIPVPKFS
LLIPEDIF

BLAST