GenomeNet

>mmu:13349 K06574 atypical chemokine receptor 1 | (RefSeq) Ackr1, AA162249, CCBP1, CD234, Darc, Dfy, ESTM35, FY, GPD; atypical chemokine receptor 1 (Duffy blood group) (A)
MGNCLYPVENLSLDKNGTQFTFDSWNYSFEDNYSYELSSDYSLTPAAPCYSCNLLGRSSL
PFFMLTSVLGMLASGGILFAILRPFFHWQICPSWPILAELAVGSALFSIAVPILAPGLHS
AHSTALCNLGYWVWYTSAFAQALLIGCYACLNPRLNIGQLRGFTLGLSVGLWGAAALLGL
PVALASDAYNGFCAFPSSRDMEALKYMHYAICFTIFTVLPPTLLAAKGLKIALSKGPGPW
VSVLWIWFIFWWPHGMVLIFDALVRSKIVLLYTCQSQKILDAMLNVTEALSMLHCVATPL
LLALFCHQTTRRSLSSLSLPTRQASQMDALAGKS

BLAST