GenomeNet

>mmu:22222 K10625 E3 ubiquitin-protein ligase UBR1 [EC:2.3.2.27] | (RefSeq) Ubr1, AI504731; ubiquitin protein ligase E3 component n-recognin 1 (A)
MADEEMDGAERMDVSPEPPLAPQRPASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLE
KQEESVQMSILTPLEWYLFGEDPDICLEKLKHSGAFQLCGKVFKSGETTYSCRDCAIDPT
CVLCMDCFQSSVHKNHRYKMHTSTGGGFCDCGDTEAWKTGPFCVDHEPGRAGTTKESLHC
PLNEEVIAQARRIFPSVIKYIVEMTIWEEEKELPPELQIREKNERYYCVLFNDEHHSYDH
VIYSLQRALDCELAEAQLHTTAIDKEGRRAVKAGVYATCQEAKEDIKSHSENVSQHPLHV
EVLHSVVMAHQKFALRLGSWMNKIMSYSSDFRQIFCQACLVEEPGSENPCLISRLMLWDA
KLYKGARKILHELIFSSFFMEMEYKKLFAMEFVKYYKQLQKEYISDDHERSISITALSVQ
MLTVPTLARHLIEEQNVISVITETLLEVLPEYLDRNNKFNFQGYSQDKLGRVYAVICDLK
YILISKPVIWTERLRAQFLEGFRSFLKILTCMQGMEEIRRQVGQHIEVDPDWEAAIAIQM
QLKNILLMFQEWCACDEDLLLVAYKECHKAVMRCSTNFMSSTKTVVQLCGHSLETKSYKV
SEDLVSIHLPLSRTLAGLHVRLSRLGAISRLHEFVPFDGFQVEVLVEYPLRCLVLVAQVV
AEMWRRNGLSLISQVFYYQDVKCREEMYDKDIIMLQIGASIMDPNKFLLLVLQRYELTDA
FNKTISTKDQDLIKQYNTLIEEMLQVLIYIVGERYVPGVGNVTREEVIMREITHLLCIEP
MPHSAIARNLPENENNETGLENVINKVATFKKPGVSGHGVYELKDESLKDFNMYFYHYSK
TQHSKAEHMQKKRRKQENKDEALPPPPPPEFCPAFSKVVNLLSCDVMMYILRTIFERAVD
MESNLWTEGMLQMAFHILALGLLEEKQQLQKAPEEEVAFDFYHKASRLGSSAMNAQNIQM
LLEKLKGIPQLESQKDMITWILQMFDTVKRLREKSCLVVATTSGLECVKSEEITHDKEKA
ERKRKAEAARLHRQKIMAQMSALQKNFIETHKLMYDNTSEVTGKEDSIMEEESTSAVSEA
SRIALGPKRGPAVTEKEVLTCILCQEEQEVKLENNAMVLSACVQKSTALTQHRGKPVDHL
GETLDPLFMDPDLAHGTYTGSCGHVMHAVCWQKYFEAVQLSSQQRIHVDLFDLESGEYLC
PLCKSLCNTVIPIIPLQPQKINSENAEALAQLLTLARWIQTVLARISGYNIKHAKGEAPA
VPVLFNQGMGDSTFEFHSILSFGVQSSVKYSNSIKEMVILFATTIYRIGLKVPPDELDPR
VPMMTWSTCAFTIQAIENLLGDEGKPLFGALQNRQHNGLKALMQFAVAQRTTCPQVLIHK
HLARLLSVILPNLQSENTPGLLSVDLFHVLVGAVLAFPSLYWDDTVDLQPSPLSSSYNHL
YLFHLITMAHMLQILLTTDTDLSSGPPLAEGEEDSEEARCASAFFVEVSQHTDGLAGCGA
PGWYLWLSLRNGITPYLRCAALLFHYLLGVAPPEELFANSAEGEFSALCSYLSLPTNLFL
LFQEYWDTIRPLLQRWCGDPALLKSLKQKSAVVRYPRKRNSLIELPEDYSCLLNQASHFR
CPRSADDERKHPVLCLFCGAILCSQNICCQEIVNGEEVGACVFHALHCGAGVCIFLKIRE
CRVVLVEGKARGCAYPAPYLDEYGETDPGLKRGNPLHLSRERYRKLHLVWQQHCIIEEIA
RSQETNQMLFGFNWQLL

BLAST