GenomeNet

>mmu:27967 K12841 calcium homeostasis endoplasmic reticulum protein | (RefSeq) Cherp, 5730408I11Rik, D8Wsu96e, DAN16, Scaf6; calcium homeostasis endoplasmic reticulum protein (A)
MEMPMPPDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKL
ALEQQQLICKQQAPELEPTSAMPPLPQPPLAPTASLTPAQGTPSMDELIQQSQWSLQQQE
QHLLALRQEQVTTAVAHAVEQQMQKLLEETQLDMSEFDNLLQPIIDTCTKDAISAGKNWM
FSNAKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKV
VVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQSPALGLGQYQATLINEYS
SVVQPVQLAFQQQIQSLKTQHEEFVSSLAQQQQQQQQQQQQQPQPQPQPQIQLPQMEADV
KATPPPPAPPPASAPAPTIPPTTQPDDNKPPIQMPGSSEYDTSAGVQDPAAAGPRGPGPH
EQIPPNKPPWFDQPHPVAPWGQQQPPEQPPYPHHQGGPPHCPPWNNSHEGMWGEQRGDPG
WNGQRDAPWNNQPDPNWNNQFEGPWNNQHEPPPWGGAQREPPFRMQRPPHFRGPFPPHQQ
HPQFNQPPHPHNFNRFPPRFMQDDFPPRHPFERPPYPHRFDYPQGDFPADMGPPHHHPGH
RMPHPGINEHPPWAGPQHPDFGPPPHGFNGQPPHMRRQGPPHINHDDPSLVPNVPYFDLP
AGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQN
GLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSSSRSSSRSSKSSRSSSRSHSRS
RSRSSSRSRSRSRSRSRSSRSRSRSRSRSRSRSKSYSPGRRRRSRSRSPTPPSAAGLGSN
SAPPIPDSRLGEENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVA
LDDPYENYRRNKSYSFIARMKARDEFSTFGTRKEEKED

BLAST