GenomeNet

>mmu:30960 K06096 vesicle-associated membrane protein-associated protein A | (RefSeq) Vapa, 33kDa, VAP33; vesicle-associated membrane protein, associated protein A (A)
MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYC
VRPNSGIIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDE
LMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLPKPHSVSLNDTETRKLMEECK
RLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIAAIFI
GFFLGKFIL

BLAST