GenomeNet

>mmu:53328 K17278 membrane-associated progesterone receptor component | (RefSeq) Pgrmc1, AA415812, HPR6.6, PPMR, Vema, mPR; progesterone receptor membrane component 1 (A)
MAAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDD
EPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD
ASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLLKEGEEPTVY
SDDEEPKDETARKNE

BLAST