GenomeNet

>mmu:66540 no KO assigned | (RefSeq) Fam107b, 3110001A13Rik, AA589595, AA959793, AI132312; family with sequence similarity 107, member B (A)
MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKR
RRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRR
TGQEVAQAQES

BLAST