GenomeNet

>mmu:68953 K12191 charged multivesicular body protein 2A | (RefSeq) Chmp2a, 1500016L11Rik, mVps2; charged multivesicular body protein 2A (A)
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVR
IMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLP
QIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELS
NLPSTGGSLSVAAGGKKAEATASALADADADLEERLKNLRRD

BLAST