GenomeNet

>mmx:MmarC6_1727 K03411 chemotaxis protein CheD [EC:3.5.1.44] | (GenBank) CheD (A)
MVLKVKMGDIGVAKSPESIETLLGSCVAIILYDRGKKVGGVAHVMLPKSRNAAEKNPGKY
ADTALPELLDRMTKLGARKDKLTAKLAGGAAMFKCNSNTIDVGKKNIEASKEEVRKVGLR
IASEDLGGDIGRTITLSLKDGSVIVRKGAELKTI

BLAST