GenomeNet

>mpc:Mar181_0663 K11894 type VI secretion system protein ImpI | (GenBank) FHA domain containing protein (A)
MSISLQLVELPENEQVTSRQISLPDSGGTIGRSFDCTIQLPDFNRSLSRVHAEIVLSQKG
RYQLIDRSTNGVYVNGRLIGKGAKHTLADGDNIKMGAYTLLVSDMESLFVQEDIPVLDES
LDDPNSAVFDVKNLEMDSPIKANNPIDQKSYNSLFNEEEADVPSFSKKNVMEEDSFGYDP
FESMQEDLQMRDPNEVTEVDEDAEVIQFNANDLAVSTYNEARDEEKRALHNSVMQLNKII
EQQQNTLSGSIAHERLMSCLEATFEKFIAELSPVNLEDEFNSYLSGWGAKDKKYWSLYKK
QFIRKQERGEYYRQFYALLFEELREKR

BLAST