GenomeNet

>mpha:105828446 K02365 separase [EC:3.4.22.49] | (RefSeq) separin isoform X1 (A)
MAHITNKIVQILHECHPNKENFKDKTKNLNGSKERNESKKELEKKKLEKIKSNTEKLLTN
AQCNYVGSIEYSSLNKMLAICNLEIGNESTAIHHLVEAHAVILRQHILHRYQKTKMRESI
WNESQIYGLKPTYVKFETRFTDNNESLKVKLLDLPKEWYMIQVTAQYESPTVLRYEKQIS
SVMHAVHITILPTGTSDMEPLCVTVPRPMTQVSYDICKEIQKLLDGYTSALKTTYTNHKQ
YWMMRANQNNKMKTAINGLENIWLREWRVLFMADPIENLEIVDEIHQMIDKLISDFKFPT
DISKRCRWLLKKVSIGACFLTREEIARAIKFLLPECEKLANNIILSIYGKLPYIKKLENT
KRKTLILIIDEYMDYIAFEAMEIIKNHPVTRFPSLHVAYALFKEHEDTIVEGCKIIKARE
NMGICVVNPSGDLNKMEKRMKLFMDFWLPQWKSCYNIQPSEEMFEDALINHDILMYTGHG
NGIEYLSGEDIERMRVKSTVLLFGCSSVKLLVIGGRYPPYGVSNQYLIACSPCLLGMLWE
VTDADIDKMTANFMSNWIPSSSEKSWTEVDMDSWNYGTLKFIKNRRDGVKAKTEMESEML
RAVAKSKNSCSHYMTAAAIVARGLPIKIV

BLAST