GenomeNet

>mpha:105834798 K08867 WNK lysine deficient protein kinase [EC:2.7.11.1] | (RefSeq) serine/threonine-protein kinase WNK1 isoform X1 (A)
MPRCYNDSKTVSSVNSNYKHGTDDIILTQSHAFSIGSQLNVDEDPPVVEKSHRRLRCDLS
PVPTSANSNLNIKFLGLKGNKGVRQDHQVSTGSGGHRERNREIKKRAAIGNTVRGFFSSG
HSRQDRYETNRQRSSGGTGGGLSSLCPKLVASGISDGQSGSNLGVGHLASPESGVVQRIH
AHTHRRQRKLSIVTQAGPSANTTGDRKVLSNISRSANISKKQIRIQRHDQSTDSLSITSN
GLATSSPSCKKKVLSALRISDRSSTPSVNSSSFDHENDRSFSDAEEALAATENAFTTLGS
SSIPSTPVSKAKSAKLGKNEEANVEHVPVECSDSSRNAADVQHVILNEFEQKNVMSIKSS
AVHELHAVNQESIINDKQKSSSSTLDARSISSSDQKVLKHKNINSAEKMIEHHNSKDIET
ANVERDLNDTTISMEMNSTDDSNEGKQGKNRKSEEYIDGGDDTNKEITDPLNAVSSTKEE
KITRVKSNVNLSEEVIKNSRFVTSKVLEEVTDADTKTVDVEKGEEERVTIYDDDGTSISD
IVATQALHESLSKLGKVPPLDSEIDENTTLRDEAKMREHSEKDVVTQEETAEGFIGPLLD
ENFKADEKLSQKTMAMEEVQNLLMKVKVQTVEDDDDEEKAVGISPDGRFLKFEEEIGRGS
FKTVYRGLDTQTGVAVAWCELQEKKLNKTERLRFREEAEMLKGLQHPNIVRFYDYWEVTL
TRRKYIVLVTELMTSGTLKTYLRRFKKINPKVVKSWCRQILKGLSFLHSRSPPIIHRDLK
CDNIFITGTTGSVKIGDLGLATLKNRSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMC
MLEMATSEYPYSECTGPAQIYKRVVSGVKPQSYDKVENPEVRDIIEMCIRLKKEERPLVK
DLLNHEFFADDVGLKLEMVSRDSAVADTELSRVEFRLRVLDPKKRSNKHKENEAIQFDFD
IQADNAEEVALEMAKSSLILEEDAKAVAKMLKSQITTLLREREDRKAKEEKERLDRENAG
TTTDVTANAANAESLLQQQLLLQQMQLQQQQQQQQQQQPQIQSNINIQMQNPVSMQLPQT
QMPIQQQQLQSTAQQAPQHNLQAQQVQLVQQQPIIQQQTPVVQPQQAQQIQYQQQIQQQY
QQQQQQQYPQHVPQSLNANSPQCSTPQNLQAQPQFPQVQQQQHVHQQQQYIQLNQMSVPQ
QIPHQMQQQMQPQMQILPQQQHMHQQLQQQQYVAQPQLQHVQQLHQHTVGSPPVQNQQYY
QQSAAGSSGYVSAGSLYQQTAMPQQIFHTYTTSTNPSGHVEILSSTQTATQIYSHTSLPA
AGTVPVSSQSQYIPSAGGQVQTPIPSAIGVNNTSTMPHMQNVSTSTIPNIQNAPTLLGNP
QPQSQQNILVQMQYSQSTNVMPNSMSITPNMANISAQSSNNLQQQHQHFLSNVDQCPTTD
RSSLIKQDTMDSIQSLPPDLSINLPQDQITVPAPVVMSVAQQTVASNDGVTLENSESVPA
SERSRIKRSGTKRKKPGIKLTVLSVSSGEGQSMTVECQLDTSKQKTVTFKFDRDDMVPTD
IANNLVAENLLPQSQCETFIELIEDIVKQLRLDPTRTLPLVAHGPPDQSAGGSPVTSRRP
RDRDHSLDTAKQVRHGSLTRQSSHRSSYKVHRRHRSRDETSNTSTPTKLLPIDQIISHIA
NTTLEKQQVAQTPDSQAGAENTSAEASRRSSTSTQNTDTLTPTNIPSDPTDNQETVISAT
SAKTVVEAQNNIQDDANNSAFKSYQTFLTHAQTQIQDKTVSVGYASEVSKESQEHDVVDI
KESGITKEINTPIDISAEVSTLTVPTPMRKISRFLVSPVLEQKNIAADEESSTVGERVDC
MNVTTSQLASQPAAPTANVEQSIVKNEEHMEANVLEVQSVATLDSTSNNEMMVQNIPYVM
EQTDSTQQILQPGQQSIGLQQNIIQMQQVTGHVQQTTTIGQSKQHTIIVQGSTITSQQTS
QQIPQTSVQHFVPVNSQELQSQPLHSNGLVQTQAQYSNQAMMQPGVMMQPPQQQIPMQQG
IMQMHVQAEQMQPQRPAVQQFVPQQMQPPTQQYVILSGPMQPVQPITTMDDRNRRVSSLP
ATSNVQSSDSQISELSGITEEKRQVTNSSIPVTHMQHVQVVPQDISGTVPLSQNVVEATQ
PLHQNVQQVSGTLPPSMPVPVTTSVHPVVTATDTSAPKVAIKTKEISSTLPDLAQNLANI
LSNPKSKSTTPHSLANHEQPAAVSNVVAPASVDYKPVQSEQYFQPIQPETNQLQIQPPIQ
HNYQGQIVHQGYQGQQNFQQAFQNQPVLQQNQVQSIPQSIPVTIPPQQIDAQSQMVQSML
QNVSNQSTAPGKWIVTNQAPIQQPMRPNQPQPLPNQLQLQQISLQPQMHQQQIIQDQQHN
ESFVVNQLDQSHLHLKLPEQQPAKSLEIENPESSSLNCIRRISSDCQLITSENENSSHDV
TPEHTLVESIDSTSILQQQLSQSQQQQQLQHRKLSQQNSLDKMSDVNGVGNIGGGVGPQT
IADLHQKLVQVTSQPSESLNVGTPPISYPATPYNNQMVGGYDAYMHSLQQKLFNIGVPVS
SANAACPLSPQTTIHSSNILTDTQADTTIEGSIVTQDSSNAFALSQTNAECSLDSPIPGA
PVGSENMSPSKENVKIRAQRPGSRLQELEQELAKIHRGSVFAATIQPLTPPISAQTQNLL
TTAQSVSMIPVATVTPNIVTPRSGTNTPIQQTELQDATNEKTNPIQPTRKISRFVVSKVA
GPPVHSNAAINQHVDIGRSQLQTEELRTSERQNILSYTDDLHGISAQISHSRENSVPPVM
QATHGTNISNIEPEKEDRFVALTPSEEYQLLIKRQTLELETLQKRHREELERFQQHQLQL
LIQQQASALHHQHHPLLYHTVATNISGPRIPGTEDYLMFSTAPQTPLQKGSNNYPDTEET
LRLAMQKLKQTPLQLQPQQASAGIPHAYVIPIPVVPSESMQSVVSQQGNNCLNDVSEGID
MTYSTAVGNPTQYQFAPILSEGTNIPSTTGPLPASASLSISGATSAYIQYHESQPLPNFQ
TFTCTPHGGFFLPPGYRLIYTPPTTQSQPTTPATSHVTNSSRDDTPPTAELHHSTTAENS
TVPPSHSDQ

BLAST