GenomeNet

>msq:BKP64_15215 K03581 exodeoxyribonuclease V alpha subunit [EC:3.1.11.5] | (GenBank) exodeoxyribonuclease V subunit alpha (A)
MSKTRQSDQQISLDLSNEPDDKPAPSAPTRAHDTDALLASPDKMDALLDQWQQMEWIRPL
DVGFARLIRTLSAEQGEALHPLVLLLSALVSHQVGRGHVCIDLANLFADAGSILSLPPED
SVEAAGGLRTGETVCPEPDSILARVSLEDSLALLDKAQAVSDGSLTTPLVLNETRLYLRR
FWRYEQRIAEGIQARLAMSSPLQDAHSDMATTLGLALTALFGPPVDIDFQRLACALAARS
RFSVITGGPGTGKTTTVVKLLAALQAIAGKSGQRGGRKHRIRLAAPTGKAAARLNESIGG
AVSRLPLSQLPGNVTPDDIPTRVTTLHRLLGSRPDTRRFRHNRDNLLLVDILVIDEASMI
DMDLMASVFDALPATAQLILLGDKDQLASVDAGAVLGELCQRAADAHYTPETSCWLEAIT
GHSIPDNLSDASGQPLDQAVAMLRKSHRFSEDSGIRTLAEAVNTDTLDAGILRACRDGEF
DDVIWLNGRNPTPEPSNALAMICSHAVSGTPEAFREQGRGRIANHQPLPPPVGYHQYLSL
LNNHELDERSPRVDWDSLALQVLEAFSDFQILCALRKGPWGVEGINDLVARHLLAEKHIT
RAEGWYPGRPVLVTGNDYNLGLMNGDVGITFSVPWDRNQQGEPKDTLRVAFPATDGSDGI
RWISPSRLQQLETVYAMTVHKSQGSEFNHTCLVLPDRLSPIMTRELIYTGITRARNWFSL
ITGDASVLRDSVHQQVRRASGLAQRLSQP

BLAST