GenomeNet

>mthr:MSTHT_2234 K01959 pyruvate carboxylase subunit A [EC:6.4.1.1] | (GenBank) Pyruvate carboxyl transferase subunit A (A)
MFKKVLVANRGEIAIRVMRACRELGISTVAVCSEADKNALFAKYADEAYLIGPAPSSQSY
LNMEAILAVAKSTGAEAIHPGYGLLSENPVFAKRCEEEGIVFIGPPSHVIAEMGSKIRAR
NLMMKAGVPVVPGTMDAVEDVDEALKIAEEIGYPVLIKASAGGGGIGMKVVHCRDELAAA
LSSTRQMAGSAFGDSSVFIEKYAEEPRHIEIQILADGYGNTIYLSDRECSIQRRHQKLIE
EAPSPIMTPELRAKMGEAAVRVAKTIGYVNAGTVEFLYSKGNFYFLEVNTRLQVEHGITE
MVTGVDIVREQLRIAWGEKLELKQEDITINGHAIECRINAEDPLNDFAPSPGKIRGYRSA
GGPGVRVDSGVHTGYTISPYYDSMISKLCVWAKTRDAAIARMERALYEYVIVGVKTNIPF
HKAVMRNPAFRRGDLTTSFIEDQKIMESVEEVVKADAEKGATLASALEAKDKKVAAITAA
VHAYVSMAQKRQR

BLAST