GenomeNet

>myb:102242927 K19524 carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21] | (RefSeq) CPT1C; carnitine palmitoyltransferase 1C (A)
MAEAHQAVGFRPSLTSDGAEADLSASALQDIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLTEKIKELLPDWGGQHHRLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVLSDEDFDWTAGLAQEFLRLQASLLQWYLQLKSWWASNYVSDWWEEFV
YLRSRNSLMVNSNYYMMDFLYVTPTPVQAARAGNAVHALLLYRHRLNRQEILPTLLMGMR
PLCSAQYEKIFNTTRVPGTQKGETLSPLLALGGGTVWRGHDRWYDKSFTLIVFSNGKLGL
SVEHSWADCPVSGHMWEFTLATECFQLGYSVDGHCKGHPEPSLPRPQRLHWDLPDKVHLS
IALALRAAKTLSGDTDCHVFPFSHFGKSFIKRCHLSSDSFIQVALQLAHFRDRGHFCLTY
ESAMTRLFLEGRTETVRSCTREACNFVRAMEDREKTDSQCLSLFRLAVDKHQALLKAAMS
GQGVDRHLFALHIVSQLLHLQAPFLDQVHSEQWQLATSQIPVQQTHLFDVHNYPDYVSSG
GGFGPVDDHGYGVSYIFMGDDTVTFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQEGQ
RLKRGCRGRGEEDAGNRRGSLPGH

BLAST