GenomeNet

>myd:102752290 K08862 polo-like kinase 3 [EC:2.7.11.21] | (RefSeq) PLK3; polo like kinase 3 (A)
MPDARSLQGGFARCYEVTDTETGSAYAVKVISQSRITKPHQREKILNEIALHRGLQHRHI
VRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGIL
HRDLKLGNFFITENMELKMGDFGLATRLEPPEHRKKTICGTPNYVAPEVLQRQGHGPEAD
VWSLGCVMYTLLCGSPPFETVDLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPQDR
PSIDQILRHDFFTKGYTPDRLPINSCVTVPDLVPLSPARILFVKVTKSLFGRKKNKSKNR
PEERDEVSCLVSGLTRTSIAHQDAKPEAPAASGPAPLSLVETAPEDSSPRGTLASSGDGF
EEGLTVATVVESALCALRNCLAFMPPADQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQLS
SRRVAVLFNNGTHMALSANRKTVHYNPTSTKHVSFPVGAVPRGLQPQLGVLRYFTSYMEQ
HLMKGGDLPSVEEVEVPVPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPL
LVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYTLRLLRDRCSA

BLAST