GenomeNet

>myd:102765943 K04870 voltage-dependent calcium channel gamma-5 | (RefSeq) CACNG5; calcium voltage-gated channel auxiliary subunit gamma 5 (A)
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVVLPQNQSTEIRMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNSQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDADTYFSYKYGWSFA
FSAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC

BLAST