GenomeNet

>mze:101480171 K08765 carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21] | (RefSeq) carnitine O-palmitoyltransferase 1, liver isoform isoform X2 (A)
MSLSAQGQTMVSALVFSTLLWLSLILALRFCLKLLLSYHQWMFEKHGRMSNTTKVWVPLV
RLLSSRKPLLYSYQSSLPHLPVPAIQDTVSRYLESVRPLLTDPEFKRMSDLANEFESNLG
NRLQRYLKLKALWATNYVSDWWEEYVYLRSRGPIMVNSNYYGMDFLYVTPTSVQAARAGN
TITALLLYRRKVNREELKPSRVPGTVIPLCAAQCERMFNTTRTPGVETDVLQHWLDSEFV
AVYHRGRYFRLWVYRAGRLLSPREIEDQIQRILDDASPPLPGEEKLGALTAGDRIPWAQM
RKQYFSSGVNKRSLDIIERAAFFVTLDDEEQGMRGDDPEGNLDRYAKSLLHGKCYDRWFD
KSFSVVIYKNGKSGLNAEHSWADAPTVAHLWEYTLATDAFQLGYTEDGHCKGDVEPSLPQ
PQRLVWNIPAEVQAQVSSSLAVAQALADDVDCHVFPFREFGKGRIKKCRVSPDAFIQISL
QLAYYRDRGGFCLTYEASMTRLFREGRTETVRSCSNESCAFITALESGETEEECRRLFQL
ASERHQNLYRMAMTGAGIDRHLFCLYVVSKYLGVESPFLKEVLSEPWRLSTSQTPVQQMN
LFDLKNHPDFISLGGGFGPVADDGYGVSYIIVGEDMVNFHVSSKYSCSQTDSHRFGVQIS
KAMQDIMALLSADPKTSLSSKGTGQPQSKKLQ

BLAST