GenomeNet

>nau:109232259 K03103 multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80] | (RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1 (A)
MLKNLIILLLLPVFLQSNADESSFDVRKHLATVSRYNVAKDISANSFVSSEIPDQCVPLH
LNLVARHGTRAPTKKKIRELETLAAHLKVLLRDAKEHKQSLEKIPAWLLGWSSPWKGKLT
GGELISEGEDELYHLGIRVGEKFPDLFSEEYHPDVYSIKTTQVPRASASAVAFGMGLFNG
RGKLGPGRHRAFAVTSESRASDIVLRFHDCCQSYKAFRKSQEPNVDKLKEPVLDEITREL
VRQYGLNFTKQDVSSLWFLCKQEASLLNITNQACSLFSPSEVSLLEWTDDLELFILKGYG
DSLNYRMGVPLLEDVVHSMEQAIKAKEEGYARGTYEKARMRFAHAETLLPFSCLIGLFLE
EPEFELIQREQSLELPQKPPKSRNWRGSVVAPFAGNNMLVLYSCQLDNSSKYFVQVLHNE
RPVALPGCNSSSFCPFEVFKERIAAPHLKHDYNMLCNANMQQGQQNSASSKLSRIFSWLF
SLKNTGSSAQKVEL

BLAST