GenomeNet

>ncc:104952088 K04407 mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1] | (RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like (A)
MRRQQEREQRRREQDEKRRVEDMERRRKEEEERRRVEEEKRRADREQEYIRRQLEEEQKH
LEILQQQLLHEQAMLLENKWRELEEQRQAQQLQRQLQQEQAFLLSLQQNPSLDGNKSSQQ
QSSKPPQSGEHEGVKPLQSSEPETTQQPQSAESEKTVQNPSLERTAQPKLPVADPAPDSE
PIRESDDRYRKNIQGSPQAAQIKPPQIKPPQPPVPPRSDSSHPNGSSASEAPAMHRPVEP
QVRSHLAALKSSGSVNSSNSIASAPPLVSRPHSFSELLPSSFENLHLRNNNNKQEPHHHP
PSSSPSSSSTPARTDPQPKPQHRPNETAPSEEVPPRVRTGTKRWCSLEVVDDMAK

BLAST