GenomeNet

>nfu:107388613 K04868 voltage-dependent calcium channel gamma-3 | (RefSeq) voltage-dependent calcium channel gamma-3 subunit-like (A)
MRVCNRGMMMLLTTAGAFCAFSLMTIAVGTDYWLYSRGVCRSKNLNDNETVHKNEEVLTH
SGLWRTCCTEGIFRGVCKNIDHFPDDADYEQDAAEYLLRAVRASSLFPILSVGLLFLGGL
CVAASEFYKSRYNVILCAGILFVSAGLSNIIGIIVYISANSGDPSQSDNKKSYSYGWSFY
FGALSFVLAEMVGVLAVHVFIEKHRQLRTRGRPSLIKPPISRNSSYYRNRYYRSRRYSNR
SNHSAGDSASNTYQATFGRDQDPPIFVESKVDTLTGLPTPVTMGSEFMLYTLNSHQLPFK
HSKINVDVDDLTAGAGHNSTEMLPGDCASNRRTTPV

BLAST