GenomeNet

>ngi:103746770 K03283 heat shock 70kDa protein 1/2/6/8 | (RefSeq) Hspa6; heat shock protein family A (Hsp70) member 6 (A)
MCAPREVAIGIDLGTTYSCVGVFQQGRVEIVANDQGNRTTPSYVAFTDSERLVGDAAKGQ
AALNPHNTVFDAKRLIGRKFTDSTVQADMKHWPFQVVSEGGKPKVRVSYRGQDKAFYPEE
ISSMVLSKMKETAEAYLGQPVRHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLTLDAGVFEVKATAGDTHLGGEDFDNRLV
NHFVEEFRRKYGKDVSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKVQIHDVILVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVREAEQYKAEDEVQRDRVAA
KNSLEAHIFHVKSSLQEESLRAKIPEEDRLKVQDKCQEVLTWLDHNQLADKEEYEHQKKE
LEQICQPIFSRLYGGPGVPGGSSCGAQARQERPSTGPVIEEVD

BLAST