GenomeNet

>nmel:110397267 K13951 alcohol dehydrogenase 1/7 [EC:1.1.1.1] | (RefSeq) alcohol dehydrogenase 1-like isoform X1 (A)
MATAGKVIRCRAAVAWAVGKSLSVEEIEVAPPKAHEVRVKIVATGICRTDDHVLDGTFPD
LEFPVIPGHEGAGIVESTGEGVTSVKPGDKVILFGLPQCGECSFCLNPDSNYCLKSHLSE
PQNLLPDKTSRFTCKGKQIHHFLWISTFAEYTVVPEYTLAKIDAAAPLDKVCLLACGFST
GYGAAINTAKVKPGSTCAVFGLGGVGLSVVMGCKAAGASRIIAIDINKDKFAKAKEAGAT
ECINPRDFKKPVQQVLTEMTGHGVDYSFEVIGTADTLIAALASCNMNTGVCVLVGVPPAG
STVPIDPFLLLSGRTCKGTLLGGWRMRDAIPRLVASYLEKKFNSDLLITHTLPFAKINEG
FELLRAGKSIRTVLLF

BLAST