GenomeNet

>nmm:NMBM01240149_1528 K00605 aminomethyltransferase [EC:2.1.2.10] | (GenBank) gcvT; glycine cleavage system T protein (A)
MITLKTTPFHQAHQDAGAKPVDFAGWELPIHYGSQIAEHEAVRTDAGMFDVSHMLVTDVA
GANAKAFFRKLIANDVAKLAFVGKALYSALLNDNGGVIDDLIVYRTNEAETQYRIVSNGA
TREKDTAQFHKVGQEFGVAFNPRYDLGMLAVQGPKAIEKLLTVKPEWADVIHGLKPFQGA
DLGNDWFVARTGYTGEDGVEVILPGTEAVAFFKALQAAGVQPCGLGARDTLRMEAGMNLY
GNDMDDDTSPLEAGMGWTVDLKDESRDFVGKAALLALKEKGVAVKQVGLLLGKGGILRAH
MEVLTDKGKGETTSGVFSPSLKQSIAIARVPKDFDGDTAKVLMRGKEVDVRVLKLPFVRN
GQKQFD

BLAST