GenomeNet

>nnu:104586063 K14565 nucleolar protein 58 | (RefSeq) probable nucleolar protein 5-2 (A)
MLLLFETPAGFALFKVLDEGKLSKVESGLQDLWKEFSTSESARKVVKLKAFSKFENTSEA
LSAATLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNAVMELMRG
VRSQLTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNT
YAMRVREWYGWHFPELAKIVQDNILYAKAVKLMGNRSNAGKLDFSEILPEEVETELKEAA
VISMGTEVSDLDLMNIRDLCDQVLALSEYRAQLYDYLKSRMNAIAPNLTALVGELVGARL
IAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLIFHASLIGQAAPKLKGKI
SRSLAAKTALAIRYDALGDGQDNSMGLENRAKLEARLRNLEGRELSRSAGSTKGKPKIEF
YDKDRKKGAGALITPAKTYNTSADSILGRTTEPVIEKAEKQDEDTSPKKRKHGEAPLSQT
QEAVEGVPVTGDEKKEKKKKKKKKTDAEDIDLQNNKDSGVEPEREEAETKKNKKKKAEAE
SAEIQNEGQDVEPEAEGKKKKKKRKHEEENKMQSKKKEKKKNDE

BLAST