GenomeNet

>nto:104088031 K17434 large subunit ribosomal protein L53 | (RefSeq) uncharacterized protein LOC104088031 (A)
MLKFLSKVKIQFNALDPRTASCMEFLAQCNAPKAKESNPSCQVQVKRRTDDQPPEITVTF
VNGVEQTYDATSTPAQNIRTMILEKGQYLETEQMFREAGEKWPVIIPDEELQQPFLGIKP
KKAEEKKQ

BLAST