GenomeNet

>nto:104115058 K11206 deaminated glutathione amidase [EC:3.5.1.128] | (RefSeq) nitrilase-like protein 2 (A)
MNFCLNTQLSTRYNFTVASAGKSIAMANSVRIAAAQMTSVNNLAVNFATCSRLVKEAASA
GAKLLCFPENFSFVGDLQGESLKIAETLDGPIMKGYCSLARESNIWLSLGGFQEKGSDDA
HLRNTHVLIDDNGNIRSTYSKMHLFDVDVPGGAVYKESSFTEAGKDIVVVDSPFGRLGLT
VCYDLRFPEVYQQLRFNHDAQVLLVPAAFTTVTGQAHWEILLRARAIETQCYVIAAAQAG
KHNEKRESYGDTLIIDPWGTIVGQLSDRWSTGITVADIDFSLIDSVRAKMPVSKHRKPAE
FWNQHP

BLAST