GenomeNet

>oas:101103928 K01939 adenylosuccinate synthase [EC:6.3.4.4] | (RefSeq) ADSSL1; adenylosuccinate synthetase isozyme 1 isoform X1 (A)
MSGTRASNDRPPSAGGVKRGRLQHEAATTGSRVTVVLGAQWGDEGKGKVVDLLATDADII
SRCQGGNNAGHTVVVDGKEYDFHLLPSGIINPKAVSFIGNGVVVHLPGLFEEAEKNEKKG
LKDWEKRLIISDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTRKGIGPAYSSKAARTGL
RICDLLSDFDEFSSRFKNLAHQHQSMFPSLEVDIEGQLKRLKGFAERIRPMVRDGVYFMY
EALHGPPKKILVEGANAALLDLDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGEVYGVVKA
YTTRVGIGAFPTEQINEIGDLLQSRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTAWV
AGLDEAGHPGRPGRDQGWRGVQARREADPLLPSQPGGPAEGGGGIRDAAGVEGGHHGRPE
VGGPAPAGPELHSFRGEPRRSGSEMGWCRQVQRFDDPAVLDKAGADPSGVAHVVSFPWPA
EPTP

BLAST