GenomeNet

>och:CES85_2891 K00004 (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303] | (GenBank) zinc-binding dehydrogenase family protein (A)
MRALRFYAAKDLRVENVSAPAGSDIEPDQVLIENCFCGICGTDLHEYAYGPIFIPTEPHP
FTKAGAPQILGHEFGGVVKAVGSDVTHVTIGDRVSVQPLIMPRAGDYFADRGLYHLSTSL
ALAGLSWHSGGMAEMALLNAYNVQPIPDDLSYEEAALIEPTAVAVYACDRGGVTAGNSVL
VTGAGPIGILTAMAARAAGASQIFLSDLNDTRLQLAREKLGDVRTINPKSENVGEVVRAE
TEGNVGCDVAIECVGNEHALKNCTDAVRKQGVVVQTGLHPHENPLNWFDVTFKDIDIRGS
WAYPTHYWPRVARLIASGQIPASKIVTKTIALEDAVVEGFDRLLDPAGTQLKILIDLKR

BLAST