GenomeNet

>oeu:111380119 K01724 4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96] | (RefSeq) uncharacterized protein LOC111380119 (A)
MASTTHLPFSPPLSIFKNPIKKSQVVVSFTKPRLQVKIHATGTDMVGDFGARDPFPAEIE
SNFTEKVLGNVDTEHKILIPTAAALSLSQQQCTPISHLQQPIPEDEAKKMLFKVVGWRLV
HEEGGIKLQGLWKLRDFKCAVELINRICRVVEPTGHFPTLHLEQPNQVRAELWTASIGGL
SMNDFIVAAKIDEIKTSDLVLRKRVWA

BLAST