GenomeNet

>oor:101274865 K12321 guanylate cyclase 2D/E [EC:4.6.1.2] | (RefSeq) LOW QUALITY PROTEIN: olfactory guanylyl cyclase GC-D-like (A)
MTILIVNTLHILVFTTALPGNGNPILPQAQAPSSPHTPHPACPRRLSLGYCSGLPAGLLA
SALVLDLTVAGKQPPGGFLALALTCVLVLAGRPSLASSEISRLSIQQLQLVRGPYWILLT
AQELTFIHRPLSRWMRELWHENIATFLGFFVAPGVSALLLEHCARGSLEDLLRNEALRLD
WTLKASLVLDMIRGVWYLHHRHFPHGCLKSRNCVVAGCFVLKVTDHGYAELLDAQWAPRP
RPAPEELLLTAPELLRGPGAPGRGTLKGDTFSVGIILPEVLTWGPHYGSPGLSAEEIIRK
VVSPPRLCRPLVSPDHGPPECIQLMELCWEEAPEDRPNLDQIYTQFKSINQGKKTSIADS
MLQMLEKYSQNLEDLIQEWTEELGLERQKMERLLSQMLLPSVAEALKMGATVEPEYFDQV
TIYFSDTVGFTTISALSEPIEVVGLLNDLYTLFDAVLGNHDMYKVETIGDAXMVATGLPQ
RNRSQHAAEITNMALDILSSVGDFRMRHVPTVSIRIRAGLHSEPCMAGVVGLTMSQYCLS
GDTVNTTSRMESTGIPYRIHVCISTAQTLLSLDEGYRIDIRGQTELKGRGFKETYWLGGK
AGFPRRLPTPLDIKPRVMDEIVLPP

BLAST