GenomeNet

>pac:PPA0853 no KO assigned | (GenBank) hypothetical protein (A)
MTFLYASEADETLERIDLEGAQNGIAHLRQLGFGGETTGSAFTDSEMYDSVPAEQWDYSV
KVDR

BLAST