GenomeNet

>paf:PAM18_3382 K11894 type VI secretion system protein ImpI | (GenBank) hypothetical protein (A)
MELVLEMLSAKQFVPTELCSKTFGRNGGLIGRGGECDWAIPDRKRHLSKQHARVSYRNGA
FYLTDTSSNGIRAGNGSRLPHGEPQRIEQDSVFLLGDFEIRARLLREPDELAMDVGRPQP
AGSIIPDDAFLALDPLQALDQDGADAYELDDLSAIAQPSHEAGARADYARIDMESLVVPE
LVPAPAAPQEPVESPPPERDEAFWQRFGQALGVDLEGLDGAAREALAIDAAGLLRQCIGG
LQQSLRTRSELKNELRLSLSTLRDTGKNPLRFSADAGEALGHLLRDGKPGQLSGEQAVAR
SFRDLQAHQVALLGASRAAVRATLEHFSPQQLALRFERDGRRPLLATSGSRWRAYGRYHQ
SLCQDDDWSERLLARDFAQAYEEQVRLISTLYTEHQG

BLAST