GenomeNet

>pale:102894573 K04868 voltage-dependent calcium channel gamma-3 | (RefSeq) CACNG3; voltage-dependent calcium channel gamma-3 subunit (A)
MRMCDRGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTGDNETSRKNEEVMTH
SGLWRTCCLEGTFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSIFPILSVTLLFFGGL
CVAASELHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPVSKGFHAIPSTDISMFTLSRDPSKITMGTLLNSERDHTFLQFHNSTPKELK
ESLHNDPANRRTTPV

BLAST