GenomeNet

>pam:PANA_0809 K01962 acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15] | (GenBank) accA; AccA (A)
MSLNYLDFEQPIAELEAKIDSLTSIGRQDDKHVNLDEEVKRLREKSVELTRKIFADLGAW
QIAQLARHPLRPYTFDYVRNAFDDFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKG
RETKEKIRRNFGMPAPEGYRKALRLMEMAERFKMPILTFIDTPGAYPGVGAEERGQSEAI
ARNLREMSGLKVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSA
DKAPLAAEAMGITAPRLKELKLIDSVIPEPLGGAHRHPVEMAQSLKQQLLADLADLEGLS
TEELLDRRYQRLMSYGYA

BLAST