GenomeNet

>pam:PANA_3571 K02160 acetyl-CoA carboxylase biotin carboxyl carrier protein | (GenBank) accB; AccB (A)
MDIRKIKKLIELVEESGISELEISEGEESVRISRAPANTGYPMMQQAYAAPVAQQPALAT
AVAPVAAVAEAAPAEISGHIVRSPMVGTFYRTPSPDAKAFVEVGQKVNAGDTLCIVEAMK
MMNQIEADKSGVVKAILVESGQPVEFDEPLVVIE

BLAST