GenomeNet

>pami:JCM7686_pAMI6p161 K11902 type VI secretion system protein ImpA | (GenBank) type VI secretion system protein ImpA (A)
MALDWLLDPVTEEAPCGPDLERSDDGEFLDYYFEAEGRLPERYFTPGAPNLLGGTEDLVF
DPRSVQLKREVGAITALLQRSRDLRLLSLLARFQILAARPADFATTLEAMAELMAARLNE
VHPQLDEGVSERRGALDALAEQTTVVMPLVYLPLLSHADVSYRRYLVASGEVVPRGAEAE
SEATTADLISLLKNPSNAPALSQLFAELTRAALALRRIAGLCMTNGHRAFTPDFTPALDT
ISDLQRLIREAVPGLTPWSETADAALPEVAAPIEAATAAPEDSAPVAVVAPIPTAGAVQI
ANHAEARATIEAAETYLAAFEPSSLSLLLVTQARLLVGKSIVEAIELLRPQQAELASFNL
GSGLGFSLDMGRLRMLAQSVPGNQGDSPAAAETKPAAIRDRGELAASLRGVEDFYLRNEP
ASPVPVLLGGARTMLTKTFDAILSELLPSEAQQV

BLAST