GenomeNet

>pau:PA14_59660 no KO assigned | (GenBank) conserved hypothetical protein (A)
MATSVVRALQLATLLVLVNIAQAAVDPPPAYKQIALPKGVPAEVLYSVALTESKVLLRGE
YVPWPWTLNVAGKSYYYATRTAACTALLAAINLYGAKSVDSGLGQVNIGWNGHRFSSPCE
SLDPYKNLDATSDILIEQRDALYASAPGRPVDWIQVAGRYHRPAGGAPAAKYRRTVSRHL
SQVLGVNLLVTNP

BLAST