GenomeNet

>pavi:110755282 K20184 vacuolar protein sorting-associated protein 41 | (RefSeq) vacuolar protein sorting-associated protein 41 homolog (A)
MAPIPPDNGVEGDDEREEEGEEEEEEEEEEEEEEDEEEEEEPRLKYQRMGGSIPTLLTSD
VATCIAVAERMIALGTHGGTVHILDFLGNQVKEFPAHTAAVNDLSFDIEGEYIGSCSDDG
SVIINSLFTDEKMRFEYHRPMKAIALDPDYAKKSSRRFAAGGLAGHLYYNTKRWLGFRDQ
VLHSGEGPIHAVKWRTSLIAWANDAGVKVYDTANDQRITFIERPRGSPRPELLLPHLVWQ
DDTLLVIGWGTSIKITSIKTNQSRAANGTVKHVSMPMSNMNQVDIVASFQTSYFISGVAP
FGDSLVVLAYIPGEEDGEKEFSSSVPSRQGNAQRPEVRIVTWNNDELSTDALPVHGFEHY
KAKDYSLAHAPFSGSSYAGGQWAEGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLQHGWHE
KALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAH
LRQLPVLVPYIPTENPRLRDTAYEVALVALATNPSFHTELLSTVKSWPPVIYSSLPVISA
IEPQLNASSMTDALKEALAELYVIDGQYEKAFSLYADLLKPDIFSFIEKHNLYDSIREKV
VQLMMLDCKQAVPLLIQNKDLITPSEVVKQLLNARDKCDSRYFLHAYLHSLFEANPHAGK
DFHDMQVELYADYDSKMLLPFLRSSQHYKLEKAYEICIGRGLLREQVFILGRMGNAKQAL
SVIINNLGDIEEAVEFVNMQHDDELWEELIQQCLHKPEMVGVLLEHTVGNLDPLYIVNMV
PNGLEIPRLRDRLVKIITNYRTETSLRHGCNDILKADIVNLLVKYYKEAIHGIYLSNEED
EARTKRNDSRASQVIEKSPGVRSMEVKSKPRGGARCCMCFDPFSIQSLNVIVFFCCHAYH
MTCLMDSTYTSGIKGTGATSSERVADNEYDDRVVEEDDDDTQSGDSRMRCILCTTAASRV
R

BLAST